DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42404 and dgcr2

DIOPT Version :9

Sequence 1:NP_001247118.1 Gene:CG42404 / 41842 FlyBaseID:FBgn0259823 Length:1133 Species:Drosophila melanogaster
Sequence 2:XP_012818344.1 Gene:dgcr2 / 549594 XenbaseID:XB-GENE-970772 Length:562 Species:Xenopus tropicalis


Alignment Length:254 Identity:69/254 - (27%)
Similarity:111/254 - (43%) Gaps:52/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCRDYNGKMYETGMHYMP-GPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVIC 91
            :|.|....:.:.|.::.| |.|.|..|.|.:|.|:.|...|||....|:.::.  ....||:..|
 Frog   281 TCVDIKDNIVDEGYYFTPKGDDPCLSCTCHNGEPEMCVAALCERPQGCQQYRK--DPKECCKFTC 343

  Fly    92 LDDQFSDGSTDF-----GIXLVASGITATLSLSLLFFLVNRLRQRKMRARENRQNAEDQRSIVGS 151
            ||   .|||:.|     |: |:.|.|::.|.||||.|:|:|||||:      |:..|   |::|:
 Frog   344 LD---PDGSSLFDSMASGMRLIVSCISSFLILSLLLFMVHRLRQRR------RERIE---SLIGA 396

  Fly   152 -----------IGYIAGNMGYMEGNLSAIDYSYSGAATHYPLWKPHFP-----------RGEAPP 194
                       .|:..|..|:..| |:.:..|..|....:...:|..|           ..:.||
 Frog   397 NLHHFNLGRRMPGFDYGPDGFGTG-LTPLHLSDDGEGGAFHFHEPPPPYTAYKYSDIQHPDDPPP 460

  Fly   195 PYEEAVA-----ISQAEALSAQCTV----SLPASSQRTVATVSQQQQQAVAQAQAQAQA 244
            |||.:::     .|..:.:|.|..|    |..:||..:....:::.........||:|:
 Frog   461 PYEASISPDIILCSSPDQVSHQAAVLGQLSTASSSNASTPQTTEEPLPPAVLCLAQSQS 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42404NP_001247118.1 VWC 32..89 CDD:214564 16/57 (28%)
dgcr2XP_012818344.1 LDLa 41..77 CDD:238060
CLECT_DGCR2_like 126..278 CDD:153069
VWC 282..340 CDD:214564 17/59 (29%)
Extensin_2 <435..476 CDD:252669 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008412
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.