Sequence 1: | NP_001247118.1 | Gene: | CG42404 / 41842 | FlyBaseID: | FBgn0259823 | Length: | 1133 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002656.1 | Gene: | dgcr2 / 436929 | ZFINID: | ZDB-GENE-040718-404 | Length: | 536 | Species: | Danio rerio |
Alignment Length: | 209 | Identity: | 62/209 - (29%) |
---|---|---|---|
Similarity: | 88/209 - (42%) | Gaps: | 59/209 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 SCRDYNGKMYETGMHYMP-GPDSCRLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVIC 91
Fly 92 LDDQFSDGSTDF-----GIXLVASGITATLSLSLLFFLVNRLRQRKMRARENRQNAEDQRSIVGS 151
Fly 152 IGYIAGNMGYMEGNLS----AIDY----------------SYSGAATHYPLWKP----------H 186
Fly 187 FPRGEAPPPYEEAV 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42404 | NP_001247118.1 | VWC | 32..89 | CDD:214564 | 17/57 (30%) |
dgcr2 | NP_001002656.1 | LDLa | 40..76 | CDD:238060 | |
CLECT_DGCR2_like | 109..263 | CDD:153069 | |||
VWC | 267..325 | CDD:214564 | 18/59 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0008412 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR15256 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.100 |