DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and rh50

DIOPT Version :9

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001119916.1 Gene:rh50 / 791729 ZFINID:ZDB-GENE-000427-1 Length:472 Species:Danio rerio


Alignment Length:377 Identity:80/377 - (21%)
Similarity:135/377 - (35%) Gaps:83/377 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TNWVLTSSFIIFTMQTGFGMLESGCVSIKNEVNIMMKN----------------VIDI------- 69
            ||..|....:||..:....:|.:..|:..:..|.:::|                ..||       
Zfish     6 TNLRLRLPALIFASEVVIVVLYACFVTYDDHANALLQNNQTRHMENSFYQNYPFFADIQVMIFIG 70

  Fly    70 ---VLGGFTYWLFGYGMSFGRGPLSNPFIAIGDFLLDP-PVGDALMGQIFAAF------------ 118
               :|..|..:.|| ||.|             :||:.. .:..|::.|.|..|            
Zfish    71 FGCLLAFFRRYGFG-GMVF-------------NFLVATFTIQWAILIQGFFQFFYDGKIHLSVLN 121

  Fly   119 LFQLSFATTATTIVSGAMAERCNFKAYCLFSFLNTAVYCIPAGWVWGEHGFLNKLGAVDIAGSGP 183
            |....||.....|..||:..:.:.....:.:.|...::.:.      |...|..|...|..||..
Zfish   122 LINAEFACAVVLISFGAVLGKTSPVQLLIMALLEIPLFGVT------EWAVLKYLRINDAGGSIL 180

  Fly   184 VHLIGGASAFASAAMLGPRLGRY----SEGYDPLPLG--NPVNACMGLFVLWWGWLAFNSGSTYG 242
            :|:      ||....||.....|    :||:..:...  :.:.:.||...||..|.:|||..|: 
Zfish   181 IHI------FACYFGLGVTFVLYRPSLNEGHPKVSTSYQSDLLSVMGTLFLWVFWPSFNSALTF- 238

  Fly   243 VSGAKWQYAARAAVMTMMGSFGGGFTS-SIYSFWRHGGGMDIMDLINGVLGSLVSITAGC-FLYR 305
                |.....||.:.|.:|......|: ::.|.....|.:.:.|:.|..|...|::.|.. .:..
Zfish   239 ----KGDDQHRAVLHTFIGLSASTITAFALSSMLSKNGKISMADVQNVTLAGGVTVGASVDMMIS 299

  Fly   306 AWEALVIGAIGSLFCVLAMP-----LFDRMGVDDPVGASAVHGVCGIWGVIA 352
            ...|.|:|.:|...|:|...     |..::.:.|..|...:||:.|:...:|
Zfish   300 PAAAYVLGVMGCFACMLGYKYLSPVLAQKLRIQDQCGIHNLHGLTGLISSLA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 78/375 (21%)
rh50NP_001119916.1 Ammonium_transp 39..448 CDD:275788 72/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X200
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.