DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and Rhag

DIOPT Version :9

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_075411.2 Gene:Rhag / 65207 RGDID:61871 Length:450 Species:Rattus norvegicus


Alignment Length:305 Identity:76/305 - (24%)
Similarity:119/305 - (39%) Gaps:66/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GFTYWLFGYGMSFG---RGPLSN-----PFIAIGDFLLDPPVGDALMGQIFAAFLFQLSFATTAT 129
            ||..:|...|:.:|   :|.|.:     ||              .:...|.|.|       :|||
  Rat   102 GFNLFLAALGLQWGTIVQGLLHSHGLKFPF--------------RIKNMINADF-------STAT 145

  Fly   130 TIVS-GAMAERCNFKAYCLFSFLNTAVYCIPAGWVWGEHGFLNKLGAVDIAGSGPVHLIGGASAF 193
            .::| ||:..:.:.....:.:.|..||:   ||   .||.......|.|...|..:|..|.....
  Rat   146 VLISFGAVLGKTSPIQMIIMTILEIAVF---AG---NEHLVTEIFKASDTGASMTIHAFGAYFGL 204

  Fly   194 ASAAMLGPRLGRYSEGYDPLPLGNP---------VNACMGLFVLWWGWLAFNSGSTYGVSGAKWQ 249
            |.|.:|      |..|   |..|:|         :.|.:|...||..|.:|||......:.   |
  Rat   205 AVAGVL------YRSG---LKHGHPNEESVYHSDLFAMIGTLFLWMFWPSFNSAIAQPENN---Q 257

  Fly   250 YAARAAVMTMMGSFGGGFTS-SIYSFWRHGGGMDIMDLINGVLGSLVSI-TAGCFLYRAWEALVI 312
            |  ||.|.|.|.......|: ::.|.....|.:|::.:.|..|...|:: |........:.|:.|
  Rat   258 Y--RAIVNTYMSLAACVITAYALSSLVERRGRLDMVHIQNATLAGGVAVGTCADMEIPLYFAMTI 320

  Fly   313 GAIGSLFCVLA----MPLF-DRMGVDDPVGASAVHGVCGIWGVIA 352
            |:|..:..||.    .||. .::.:.|..|...:||:.|::|.:|
  Rat   321 GSIAGIISVLGYKFLSPLLAHKLMIHDTCGVHNLHGLPGVFGGLA 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 76/305 (25%)
RhagNP_075411.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..61
Ammonium_transp 71..422 CDD:275788 76/305 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X200
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.