DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and RHAG

DIOPT Version :9

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_000315.2 Gene:RHAG / 6005 HGNCID:10006 Length:409 Species:Homo sapiens


Alignment Length:423 Identity:97/423 - (22%)
Similarity:159/423 - (37%) Gaps:99/423 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LYDLSVE-DTNWVLTSSFIIFTMQTGFGMLESGCVSIKNEVNIMMKNVIDIVLGGFTYWLFGYGM 83
            |:.|.|| :|:..:.....| |..|..|:... ...:..:|::|      |.:|      ||:.|
Human    19 LFGLFVEYETDQTVLEQLNI-TKPTDMGIFFE-LYPLFQDVHVM------IFVG------FGFLM 69

  Fly    84 SFGRGPLSNPFIAIGDFLLDPPVGDALMGQIFAAFL------FQLSFA-------TTATTIVS-G 134
            :|.:   ...|.::|..||...:| ...|.|....|      |.:...       :.||.::| |
Human    70 TFLK---KYGFSSVGINLLVAALG-LQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFG 130

  Fly   135 AMAERCNFKAYCLFSFLNTAVYCIPAGWVWGEHGFLNKLGAVDIAGSGPVHLIGGASAFASAAML 199
            |:..:.:.....:.:.|....:      ...|:.......|.||..|..:|..|.....|.|.:|
Human   131 AVLGKTSPTQMLIMTILEIVFF------AHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGIL 189

  Fly   200 ---GPRLGRYSEG---YDPLPLGNPVNACMGLFVLWWGWLAFNSG-------------STYGVSG 245
               |.|.|..:|.   |..|      .|.:|...||..|.:|||.             :||    
Human   190 YRSGLRKGHENEESAYYSDL------FAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTY---- 244

  Fly   246 AKWQYAARAAVMTMMGSFGGGFTSSIYSFWRHGGGMDIMDLINGVLGSLVSI-TAGCFLYRAWEA 309
                ::..|.|:|..     .|:|.:    .|.|.::::.:.|..|...|:: |........:.:
Human   245 ----FSLAACVLTAF-----AFSSLV----EHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGS 296

  Fly   310 LVIGAIGSLFCVLA----MPLF-DRMGVDDPVGASAVHG----VCGIWGVIAVGLFADNPIPLDT 365
            ::||:|..:..||.    .||| .::.:.|..|...:||    |.|:.|::||.:.|.|     |
Human   297 MIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASN-----T 356

  Fly   366 TNGRSGLFKG---GGWYLLGIQTLSALCLACWG 395
            :........|   |...:.|:.|...|.|..||
Human   357 SMAMQAAALGSSIGTAVVGGLMTGLILKLPLWG 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 92/412 (22%)
RHAGNP_000315.2 Ammonium_transp 15..402 CDD:250217 97/423 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X200
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.