DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and RHAG

DIOPT Version :10

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_000315.2 Gene:RHAG / 6005 HGNCID:10006 Length:409 Species:Homo sapiens


Alignment Length:132 Identity:28/132 - (21%)
Similarity:48/132 - (36%) Gaps:42/132 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 PERMNYLEL--KVD---SDMKEGPVMLEGFHEKEMELWFGEMMEFDRNV-------------TKI 512
            ||.|..|:.  ::|   :|:...|..|...|.|.:.|....:....|.:             :||
Human    87 PEEMALLQSLERLDLSNNDISSLPCSLGNLHLKFLALEGNPLRTIRREIIAKGTQEVLKYLRSKI 151

  Fly   513 R-----QSQGLPPEHLDIETQ----------LKYWETTNKPEIL--------TKTTKGFTSIHQD 554
            :     |:..:|...:.:.::          ||..:.::|...|        ||||. .|||:..
Human   152 KDDRTNQNDSVPETAMTLPSEARVNIHAIATLKLLDYSDKQATLIPDDLFDATKTTL-ITSINFS 215

  Fly   555 NN 556
            .|
Human   216 KN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 AmtB 27..431 CDD:439775
RHAGNP_000315.2 Ammonium_transp 15..402 CDD:395729 28/132 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.