DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and RHBG

DIOPT Version :9

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_065140.3 Gene:RHBG / 57127 HGNCID:14572 Length:458 Species:Homo sapiens


Alignment Length:416 Identity:88/416 - (21%)
Similarity:140/416 - (33%) Gaps:104/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NHSN------YVIPGLYDLSVEDTNWVLTSSF---IIFTMQTGFGMLESGCVSIKNEVNIMMKNV 66
            ||||      :..|     |.:|.:.::...|   ::|..:.||..:                  
Human    49 NHSNADNEFYFRYP-----SFQDVHAMVFVGFGFLMVFLQRYGFSSV------------------ 90

  Fly    67 IDIVLGGFTYWLFGYGMSFGRGPLSNPFIAIGDFLLDPPVGDALMGQIFAAFLFQLSFATTATTI 131
                  |||:.|..:.:.:.        ..:..||.....|...:|   ...:....|...|..|
Human    91 ------GFTFLLAAFALQWS--------TLVQGFLHSFHGGHIHVG---VESMINADFCAGAVLI 138

  Fly   132 VSGAMAERCNFKAYCLFSFLNTAVYCIPAGWVWGEHGFLNKLGAVDIAGSGPVHLIGGASAFA-S 195
            ..||:..:.......|.:.|...::.|      .|...|:.||..|..||..:|..|...... |
Human   139 SFGAVLGKTGPTQLLLMALLEVVLFGI------NEFVLLHLLGVRDAGGSMTIHTFGAYFGLVLS 197

  Fly   196 AAMLGPRL--GRYSEG--YDPLPLGNPVNACMGLFVLWWGWLAFNSGSTYGVSGAKWQYAARAAV 256
            ..:..|:|  .::.:|  |.     :.:.|.:|...||..|.:||:..|  ..||.....|....
Human   198 RVLYRPQLEKSKHRQGSVYH-----SDLFAMIGTIFLWIFWPSFNAALT--ALGAGQHRTALNTY 255

  Fly   257 MTMMGSFGGGFTSSIYSFWRHGGGMDIMDLINGVL-GSLVSITAGCFLYRAWEALVIGAIGSLFC 320
            .::..|..|.|..|  :.....|.:|::.:.|..| |.:|..|:...:...:.||..|.:.....
Human   256 YSLAASTLGTFALS--ALVGEDGRLDMVHIQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVS 318

  Fly   321 VLAMPLF-----DRMGVDDPVGASAVHGVCGI----WGVIAVGLFA--------DNPIPLDTTNG 368
            .|....|     .:..|.|..|...:||:.|:    .||:..||..        ::..||.....
Human   319 TLGYKFFTPILESKFKVQDTCGVHNLHGMPGVLGALLGVLVAGLATHEAYGDGLESVFPLIAEGQ 383

  Fly   369 RS----------GLF-------KGGG 377
            ||          |||       .|||
Human   384 RSATSQAMHQLFGLFVTLMFASVGGG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 81/391 (21%)
RHBGNP_065140.3 Ammonium_transp 61..360 CDD:275788 72/353 (20%)
Interaction with ANK3. /evidence=ECO:0000269|PubMed:15611082 416..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X200
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.