DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amt and rhr-2

DIOPT Version :9

Sequence 1:NP_001097800.1 Gene:Amt / 41841 FlyBaseID:FBgn0038309 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_505961.1 Gene:rhr-2 / 179606 WormBaseID:WBGene00004359 Length:457 Species:Caenorhabditis elegans


Alignment Length:300 Identity:62/300 - (20%)
Similarity:96/300 - (32%) Gaps:102/300 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LMGQIFAAF----LFQLSF--------ATTATTIVSGAMAERCNFKAYCLFSFLNTAVYCIPAGW 162
            |.|.:..||    ||.:..        :..|..|..|.:..|.....:.|.:|..|.:.      
 Worm    93 LRGFMTVAFQETGLFSIGIPEMISAESSCAAVLITMGVLLGRLTPVQFLLLAFFETGIN------ 151

  Fly   163 VWGEHGFLNKLGAVDIAGSGPVHLIGGASAFASAAMLGPRLGRYSEGYDPLPLGNPVN------- 220
            |..||...|.|...|...|..||..|.....|:|.                 :|:..|       
 Worm   152 VLVEHYVFNYLHVNDSGRSLSVHTFGAYFGLAAAC-----------------VGHKKNVMEMDEH 199

  Fly   221 ---------ACMGLFVLWWGWLAFNSG-------------STY--GVSGAKWQYAARAAVMTMMG 261
                     :.:|..:||..:.:||:.             :||  ..||....:...:.|.|:  
 Worm   200 GGIHHSDLFSMIGTLLLWVFFPSFNAAIQEPEDARHRAIMNTYLAMASGTVTTFMISSCVDTL-- 262

  Fly   262 SFGGGFTSSIYSFWRHGGGMDIMDLINGVLGSLVSITAGCFLYRAWEALVIGAIGSLFCVL---- 322
               |.|...........||:.|....|.||             ..:.|:::|.|.:|..|:    
 Worm   263 ---GRFNMIHIQSSTLAGGVAIGSSANAVL-------------HPYHAVIVGVIAALLSVIGHAW 311

  Fly   323 -------AMPLFDRMGVDDPVGASAVHGVCGIW-GVIAVG 354
                   ...|||..||.:      :||:.||. |::::|
 Worm   312 ISPRLERTFHLFDTCGVHN------LHGMPGILAGLLSIG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmtNP_001097800.1 Ammonium_transp 30..428 CDD:275788 61/299 (20%)
rhr-2NP_505961.1 Ammonium_transp 21..426 CDD:366364 61/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X200
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.