DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-4 and Ankrd45

DIOPT Version :9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_030099044.2 Gene:Ankrd45 / 73844 MGIID:1921094 Length:313 Species:Mus musculus


Alignment Length:126 Identity:32/126 - (25%)
Similarity:59/126 - (46%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 GRLSKEDIERMVN-----EAEKYRNEDEKQKETIAAKNGLESYCFNM---------------KAT 552
            |||  |.::.:|.     ||..:|.  ||.::..|..:.:|  |.|.               |::
Mouse   181 GRL--ETLKALVELDVDIEALNFRG--EKARDVAARYSQVE--CVNFLDWADARLILKKIITKSS 239

  Fly   553 L---DEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKL 610
            |   |.:....|:...|::|||:.|....:||:::..|...|...::::||.:.:||:.|:
Mouse   240 LIITDPEKGPGKLFKEDKSTILNACRLKNEWLESHPEASISEIFEQKQQLEDIVSPILAKM 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 32/126 (25%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675
Ankrd45XP_030099044.2 Ank_2 123..200 CDD:403870 7/20 (35%)
ANK repeat 137..167 CDD:293786
ANK repeat 169..200 CDD:293786 7/20 (35%)
PTZ00009 <246..300 CDD:240227 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.