DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-4 and AT4G32208

DIOPT Version :9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001119093.1 Gene:AT4G32208 / 6241015 AraportID:AT4G32208 Length:153 Species:Arabidopsis thaliana


Alignment Length:153 Identity:33/153 - (21%)
Similarity:60/153 - (39%) Gaps:35/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 GRLSKEDIERMVN----------EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE--DNLKT 560
            |.|||   .|:|:          |..:....:.::||.|..||..::..::::.:|.|  :.:.:
plant    18 GMLSK---ARVVSWRAGNANGHGERSRVACSERQRKELIDTKNTADTTIYSIEKSLGEYREKIPS 79

  Fly   561 KISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGP 625
            :|:......:.| ........|.|::..|.|          ..|..::|:.:       .|.||.
plant    80 EIAKEIEDAVAD-LRSASSGDDLNEIKAKIE----------AANKAVSKIGE-------HMSGGS 126

  Fly   626 GGMPGAAGAAGAAGAGGAGPTIE 648
            ||  |:|...|:.|.....|..|
plant   127 GG--GSAPGGGSEGGSDQAPEAE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 22/115 (19%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675
AT4G32208NP_001119093.1 dnaK <47..153 CDD:234715 26/121 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000049
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.