DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-4 and prelid2

DIOPT Version :9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001016922.1 Gene:prelid2 / 549676 XenbaseID:XB-GENE-943679 Length:176 Species:Xenopus tropicalis


Alignment Length:115 Identity:23/115 - (20%)
Similarity:43/115 - (37%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 TNKENKITITNDKGRLSKEDIERMVNEAE--KYRNEDEKQKETIAAKNGLESY---CFNMKAT-- 552
            |:..||.....:|..||.:.:|...:.|.  .||      |......|.:.|:   |..:|.:  
 Frog    20 TSYLNKYPTPLEKHVLSVKTVEEKTDPATGVVYR------KRIATCNNVIPSFLRRCSILKVSNV 78

  Fly   553 -LDED---NLKTKI-------------SDSDRTTILDKCNETIKWLDANQ 585
             |:|:   ::||::             :.....::..:|.|...|.:..|
 Frog    79 YLEEESWLDMKTRVMTLETHCLTWAQYATMKEESVYKECTENSNWTEFTQ 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 23/115 (20%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675
prelid2NP_001016922.1 PRELI 18..172 CDD:368069 23/115 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.