DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-4 and AgaP_AGAP004582

DIOPT Version :9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_001237643.1 Gene:AgaP_AGAP004582 / 4577471 VectorBaseID:AGAP004582 Length:168 Species:Anopheles gambiae


Alignment Length:139 Identity:93/139 - (66%)
Similarity:112/139 - (80%) Gaps:11/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            |:|||||||||||||||||||||||||||||||||||||:|||||||||||||||||||.|:|||
Mosquito     4 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPTNTVFDA 68

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE-----------ISSMVL 124
            ||||||::||..:|:|:|||||:||:..|||||:|.:|.|:||...:|           ..|.::
Mosquito    69 KRLIGRRYDDPKIQADIKHWPFKVVNDCGKPKIQVEFKGERKTMAEKEEYDHKMQELTRACSPIM 133

  Fly   125 TKMKETAEA 133
            ||:.:.:.|
Mosquito   134 TKLHQQSGA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 93/139 (67%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 93/139 (67%)
AgaP_AGAP004582XP_001237643.1 NBD_sugar-kinase_HSP70_actin 4..>116 CDD:302596 88/111 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.