DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-4 and ANKRD45

DIOPT Version :9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_016856612.1 Gene:ANKRD45 / 339416 HGNCID:24786 Length:286 Species:Homo sapiens


Alignment Length:122 Identity:32/122 - (26%)
Similarity:53/122 - (43%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 GRLSKEDIERMVN-----EAEKYRNEDEK-------QKETIA------AKNGLESYCFNMK-ATL 553
            |||  |.::.:|.     ||..:|.|..:       |.|.:.      |:..|:.|...:. |..
Human   141 GRL--ETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVT 203

  Fly   554 DEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKL 610
            |.:....|:...|:.|||..|....:||:.:..|...|...::::||.:..||.||:
Human   204 DTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKM 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 32/122 (26%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675
ANKRD45XP_016856612.1 ANK repeat 58..94 CDD:293786
ANK 94..>182 CDD:238125 11/42 (26%)
Ank_4 97..150 CDD:290365 4/10 (40%)
ANK repeat 97..127 CDD:293786
ANK repeat 129..160 CDD:293786 7/20 (35%)
Ank_4 130..182 CDD:290365 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.