DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-4 and SLC9C2

DIOPT Version :9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_011507728.1 Gene:SLC9C2 / 284525 HGNCID:28664 Length:1129 Species:Homo sapiens


Alignment Length:279 Identity:52/279 - (18%)
Similarity:93/279 - (33%) Gaps:116/279 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 EISSMVLTKMK-----------ETAEAYL-------GKTVTNAVITVPAYFNDSQRQATKDAG-- 162
            ||:.::|.|:|           .|.:.||       ||.|      :..:|.:..:.|..|:|  
Human   835 EINKVLLKKLKALNNFPKAIPPPTPDIYLHNIIWLEGKDV------LIDFFKERAKLACFDSGDT 893

  Fly   163 -------------TIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDD 214
                         .|:|:.:|..:: ||     :|::.....:|         |:.|        
Human   894 ICKGGEMPQGIYLIISGMAILHSLS-PT-----FGIESNQRCDR---------GSRD-------- 935

  Fly   215 GIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQ 279
             :|....|.||               .:.|.....|:::        .....||       :|.|
Human   936 -MFTEFCTTGD---------------IIGELSCLLKREI--------EYTVICE-------TSLQ 969

  Fly   280 AS-IEIDSLFEGTD-FYTSI-----------TRARF-------EEL---NADLFRSTMDPVEKAL 321
            |. |.::.|:||.| |:.|:           |..::       |:|   |..:|.........:.
Human   970 ACFISLEDLYEGFDAFWPSLEYKIWLKLALSTAYQYFESSLIDEDLRFQNCVMFNQAYVETLSSY 1034

  Fly   322 RDAKLDKSVIHDIVLVGGS 340
            .|..:|...:..:::|.||
Human  1035 SDMIIDNMTMKFVIIVYGS 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 52/279 (19%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 52/279 (19%)
SLC9C2XP_011507728.1 Na_H_Exchanger 98..380 CDD:294713
Ion_trans 638..>731 CDD:278921
CAP_ED 873..980 CDD:237999 27/166 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.