DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-4 and DENND6A

DIOPT Version :9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 / 41840 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_689891.1 Gene:DENND6A / 201627 HGNCID:26635 Length:608 Species:Homo sapiens


Alignment Length:191 Identity:42/191 - (21%)
Similarity:70/191 - (36%) Gaps:51/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGIDLGTTYSCVGVF-QHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            ||.||....:...:: ||.|:    .|: .:|...|::|.|:         |...:..||..|..
Human    68 VGFDLELGQAVEVIYPQHSKL----TDR-EKTNICYLSFPDS---------NSGCLGDTQFCFRF 118

  Fly    71 KRLIGRK---------FD-DAAV--QSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMV 123
            ::..||:         || |..|  :.|..::...|...      :|..|..|:.:|.:   |:|
Human   119 RQSSGRRVSLHCLLDQFDKDLPVYLKKDPAYFYGYVYFR------QVRDKTLKRGYFQK---SLV 174

  Fly   124 L-----------TKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRII 173
            |           |.:|:.|..|..|...    .:.|..||..|......|....|.::.::
Human   175 LISKLPYIHFFHTVLKQIAPEYFEKNEP----YLEAACNDVDRWPAPVPGKTLHLPIMGVV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 42/191 (22%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 42/191 (22%)
DENND6ANP_689891.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Avl9 64..>201 CDD:331426 36/155 (23%)
DENN 171..359 CDD:325068 14/68 (21%)
SPA 270..373 CDD:312210
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.