DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and RSM10

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_010326.1 Gene:RSM10 / 851611 SGDID:S000002448 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:40/150 - (26%)
Similarity:63/150 - (42%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LRWTQPMRALSTVNTSSGVQGNLSPA--APAPEPDKLYSKL--EIELRGIDPAVLKSYTWFATTA 78
            ||.|..:|:.....::.....|:...  ||...|.| |..|  :|:||..|...|..|:.|....
Yeast     2 LRNTIALRSFIRTQSTRPYPVNVEAVYYAPLKLPIK-YGDLVADIQLRSYDNENLDFYSDFILRT 65

  Fly    79 AEHLGIE-KGKCWSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYI 142
            ..:|||. .|.  .|.....||.|::||..::.|.:..:|..||.|.:.........|...:.||
Yeast    66 GYYLGIPLTGP--KPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYI 128

  Fly   143 ERNLPEGVALQASRTELQEI 162
            .::...||.::.:..:..||
Yeast   129 TKHSMAGVGMKCNFFQRSEI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753 27/97 (28%)
RSM10NP_010326.1 Ribosomal_S10 45..141 CDD:395267 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004176
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.