DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and Mrps10

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_030105834.1 Gene:Mrps10 / 64657 MGIID:1928139 Length:278 Species:Mus musculus


Alignment Length:171 Identity:76/171 - (44%)
Similarity:103/171 - (60%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLDLYSQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAPEPDKLYSKLEIELRGIDPAVLKSY 71
            |:|:....      |:|     |:.||.             |||.||.:|.|.::..|.|||.||
Mouse   128 HVDVPKDV------TRP-----TITTSD-------------EPDTLYKRLSILVKAHDRAVLDSY 168

  Fly    72 TWFATTAAEHLGIEKGKCWSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLD 136
            .:||..||:.|||.......|||.  ||.||||||||:||||||||:||.:|.:....|||||..
Mouse   169 EYFAVLAAKELGISIKVHEPPRKI--ERFTLLKSVHIFKKHRVQYEMRTLYRCLELKHLTGSTAS 231

  Fly   137 TFLEYIERNLPEGVALQASRTELQEIPEHLRQP-----PEQ 172
            .:||||:||||||||::.::|::|::|||:::|     ||:
Mouse   232 VYLEYIQRNLPEGVAMEVTKTQIQQLPEHIKEPMWETVPEE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753 55/96 (57%)
Mrps10XP_030105834.1 Ribosomal_S10 155..250 CDD:366038 55/96 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834689
Domainoid 1 1.000 101 1.000 Domainoid score I6982
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10028
Inparanoid 1 1.050 134 1.000 Inparanoid score I4560
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004176
OrthoInspector 1 1.000 - - oto94497
orthoMCL 1 0.900 - - OOG6_106617
Panther 1 1.100 - - LDO PTHR13334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5220
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.750

Return to query results.
Submit another query.