DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and mrps10

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001153460.1 Gene:mrps10 / 565937 ZFINID:ZDB-GENE-040914-39 Length:187 Species:Danio rerio


Alignment Length:167 Identity:74/167 - (44%)
Similarity:110/167 - (65%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MRALSTV-----NTSSGVQGN------------LSPAAPA----PEPDKLYSKLEIELRGIDPAV 67
            :|.||.:     ..:|.||.:            .||.:||    .|||.||.:|.::::|.|.||
Zfish    11 LRVLSKIFHGHFTAASAVQHHTACPRLVHIASVFSPPSPAITESEEPDTLYQRLSVQVKGHDRAV 75

  Fly    68 LKSYTWFATTAAEHLGIEKGKCWSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTG 132
            |.||.:|||.||:.||:...|.:.|.| |.:::|||||.||:||||||||:|||:|.:...::||
Zfish    76 LDSYEFFATLAAKELGLSLEKVFEPPK-HIDKLTLLKSRHIFKKHRVQYEMRTHYRCIQISRITG 139

  Fly   133 STLDTFLEYIERNLPEGVALQASRTELQEIPEHLRQP 169
            |:...:||||:||||||||::.::|.:::||||:::|
Zfish   140 SSARVYLEYIQRNLPEGVAMEVTKTAMEKIPEHIQKP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753 52/96 (54%)
mrps10NP_001153460.1 Ribosomal_S10 66..161 CDD:278753 52/95 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577704
Domainoid 1 1.000 109 1.000 Domainoid score I6322
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10028
Inparanoid 1 1.050 143 1.000 Inparanoid score I4445
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528895at2759
OrthoFinder 1 1.000 - - FOG0004176
OrthoInspector 1 1.000 - - oto39448
orthoMCL 1 0.900 - - OOG6_106617
Panther 1 1.100 - - LDO PTHR13334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5220
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.