DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and MRPS10

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_011513026.1 Gene:MRPS10 / 55173 HGNCID:14502 Length:211 Species:Homo sapiens


Alignment Length:168 Identity:78/168 - (46%)
Similarity:103/168 - (61%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TVNTSSG----------------VQ-GNLSPAAP----------APEPDKLYSKLEIELRGIDPA 66
            :||||.|                || .||....|          :.|||.||.:|.:.::|.|.|
Human    32 SVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKA 96

  Fly    67 VLKSYTWFATTAAEHLGIEKGKCWSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLT 131
            ||.||.:||..||:.|||.......|||.  ||.|||:|||||||||||||:||.:|.:....||
Human    97 VLDSYEYFAVLAAKELGISIKVHEPPRKI--ERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLT 159

  Fly   132 GSTLDTFLEYIERNLPEGVALQASRTELQEIPEHLRQP 169
            |||.|.:||||:||||||||::.::|:|:::|||:::|
Human   160 GSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753 56/96 (58%)
MRPS10XP_011513026.1 Ribosomal_S10 90..182 CDD:278753 56/93 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144569
Domainoid 1 1.000 106 1.000 Domainoid score I6628
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10028
Inparanoid 1 1.050 139 1.000 Inparanoid score I4520
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528895at2759
OrthoFinder 1 1.000 - - FOG0004176
OrthoInspector 1 1.000 - - oto90914
orthoMCL 1 0.900 - - OOG6_106617
Panther 1 1.100 - - LDO PTHR13334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.