DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and mrps10

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:XP_031746338.1 Gene:mrps10 / 549745 XenbaseID:XB-GENE-6070079 Length:209 Species:Xenopus tropicalis


Alignment Length:122 Identity:69/122 - (56%)
Similarity:87/122 - (71%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EPDKLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHHERMTLLKSVHIYKKH 112
            |||.||.|:|:..:..|..||.||.:||..||:.|||...|...|:| ..||.||||||||:|||
 Frog    75 EPDTLYKKIEVLAKCHDKTVLDSYEYFAVLAAKELGINVEKVHEPKK-KIERFTLLKSVHIFKKH 138

  Fly   113 RVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLPEGVALQASRTELQEIPEHLRQP 169
            |||||:|||:|......|||||.|.:||||:|||||||||:.::|.|:.:|:|:|.|
 Frog   139 RVQYEMRTHYRCFELRHLTGSTADVYLEYIQRNLPEGVALEITKTALERLPDHVRYP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753 57/96 (59%)
mrps10XP_031746338.1 Ribosomal_S10 88..181 CDD:395267 56/93 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6318
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10028
Inparanoid 1 1.050 139 1.000 Inparanoid score I4410
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528895at2759
OrthoFinder 1 1.000 - - FOG0004176
OrthoInspector 1 1.000 - - oto104699
Panther 1 1.100 - - LDO PTHR13334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.