DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and RpS20

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster


Alignment Length:37 Identity:8/37 - (21%)
Similarity:22/37 - (59%) Gaps:7/37 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMHMKHLDLYSQAIKTLRWTQPMRALSTVNTSSGVQ 37
            |::|.:.:||:|.       ::.::.::::|...||:
  Fly    84 MRIHKRIIDLHSP-------SEIVKKITSINIEPGVE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0051
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.