DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and rsm10

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_596611.3 Gene:rsm10 / 2540539 PomBaseID:SPBC211.01 Length:228 Species:Schizosaccharomyces pombe


Alignment Length:176 Identity:47/176 - (26%)
Similarity:71/176 - (40%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TLRWTQPMRALSTVNTSSGVQGN-----------------------LSPAAPAP-EPDKLYSKLE 57
            ||...||.|...|.......:||                       |:|....| |.|.|.:.|:
pombe     8 TLPRVQPKRCFQTAIGKESPKGNSEKDQLFENPFFQQLPSNVAAVYLNPVKFNPSENDVLCASLK 72

  Fly    58 IELRGIDPAVLKSYTWFATTAAEHLGIE-KGKCWSPRKAHHERMTLLKSVHIYKKHRVQYEVRTH 121
            |  :..:...|.::|.|....|.::.|. ||....|.|.  |..|||:|..|:|..:..:|..||
pombe    73 I--KSFETPKLDTFTDFICRTAYYMKIPIKGPRPLPNKV--ESWTLLRSPFIHKSSQENFERITH 133

  Fly   122 FRYMNFHKLTGSTLDTFLEYIERNLPEGVALQASRTELQEIPEHLR 167
            .|.:..:.:...||:||..|:.:.....:.|||...|.:.|.:.|:
pombe   134 SRLIQLYSVNPVTLETFFSYLRKCNMWDLKLQAKAYEYESIDDALK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753 27/97 (28%)
rsm10NP_596611.3 rpsJ_bact 71..166 CDD:130121 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2082
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004176
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.