DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS10 and mrps-10

DIOPT Version :9

Sequence 1:NP_524355.2 Gene:mRpS10 / 41838 FlyBaseID:FBgn0038307 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_499685.1 Gene:mrps-10 / 189618 WormBaseID:WBGene00012556 Length:156 Species:Caenorhabditis elegans


Alignment Length:161 Identity:65/161 - (40%)
Similarity:86/161 - (53%) Gaps:29/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LYSQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAPEPDKLYSKLEIELRGIDPAVLKSYTWF 74
            |.|::|:||        ..|||.:...|      ..|..||||||.:|||.||.|.|||||||.|
 Worm    12 LISRSIRTL--------APTVNPAEQQQ------VQAVLPDKLYSSVEIEYRGHDKAVLKSYTSF 62

  Fly    75 ATTAAEHLGIEKGKC-------WSPRKAHHERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTG 132
            .....:||.|.:|:.       |.        ...|:|..::||:::.||.|||...:....:||
 Worm    63 LQQVCQHLEIPQGRLEVLPYIRWV--------QPALRSKFVHKKYKLHYETRTHISKLEILNVTG 119

  Fly   133 STLDTFLEYIERNLPEGVALQASRTELQEIP 163
            ||..||||||:||:||||.::...||||.:|
 Worm   120 STASTFLEYIQRNIPEGVGMRVGFTELQPLP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS10NP_524355.2 Ribosomal_S10 57..154 CDD:278753 44/103 (43%)
mrps-10NP_499685.1 Ribosomal_S10 45..141 CDD:278753 44/103 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158325
Domainoid 1 1.000 78 1.000 Domainoid score I5715
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10028
Inparanoid 1 1.050 102 1.000 Inparanoid score I3557
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48187
OrthoDB 1 1.010 - - D1528895at2759
OrthoFinder 1 1.000 - - FOG0004176
OrthoInspector 1 1.000 - - oto19544
orthoMCL 1 0.900 - - OOG6_106617
Panther 1 1.100 - - LDO PTHR13334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5220
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.