DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and OMS1

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_010602.3 Gene:OMS1 / 851911 SGDID:S000002724 Length:471 Species:Saccharomyces cerevisiae


Alignment Length:416 Identity:82/416 - (19%)
Similarity:141/416 - (33%) Gaps:145/416 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HKVNLSQLQRKFEMDQYSFIKLINYIR----------------AKKISAEQLLSAEHPL-W---- 116
            :|.|.|.:.     |..|..||.|..:                ||:...|||.|....: |    
Yeast    37 YKYNSSHID-----DDKSKKKLKNVFQMNSNRVIRKQKTKEELAKERFEEQLRSPNRFVRWGAIA 96

  Fly   117 QDEKYLQP------GEYEPWLCYDYEVLKTDGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRN 175
            :.||:.:.      |.|..:|.|              .:...::..|:..:|.:...:..|...|
Yeast    97 RSEKFSKGMTKYMIGAYVIFLIY--------------GLFFTKKLFAKDKELERLLKKQEEGNAN 147

  Fly   176 DYKALLQKVHADGEPKGSDQSVPRNNVCLDNEYFKSYAHFGI----------------HHEMLSD 224
            :|:||..| ...|:.:..|:        |..|.:|.....||                :.::|..
Yeast   148 EYEALRIK-ELKGKLRRRDE--------LKLEEYKKMQEEGIENFDDIRVQNFDQNKLNEQILPA 203

  Fly   225 KVRTSTY--------RASLLQNEAVVRGK-----------TVLDVGCGTGILSIFASKAGAARVV 270
            :..|:.|        :|..::...:..||           .||:|.||||....:...:....:.
Yeast   204 RDTTNFYQEKANEYDKAINMEERVIFLGKRRKWLMKHCQGDVLEVSCGTGRNIKYLDMSRINSIT 268

  Fly   271 GIDNSDIVYTAMDIIRKN------KVENVELIKGRLED-TDLPE-------------TKYDIIIS 315
            .:|:|:   ..|:|..|.      |.:.|..:.|:.|: .||.|             .|||.|: 
Yeast   269 FLDSSE---NMMEITHKKFREKFPKYKKVAFVVGKAENLVDLAEKGKPSLENEKENQVKYDTIV- 329

  Fly   316 EWMGYFLLYESMLDSIIYARENH----LNPNGIILPSRCTLSLLGYGD----------DTLYADE 366
            |..| ...:|..:.::     |:    |.|:|.|:       ||.:|.          |......
Yeast   330 EAFG-LCSHEDPVKAL-----NNFGKLLKPDGRII-------LLEHGRGQYDFINKILDNRAERR 381

  Fly   367 VEFWSNVYEVDMSDLRKQS----IEE 388
            :..|...:.:|:.::...|    :||
Yeast   382 LNTWGCRWNLDLGEVLDDSDLELVEE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 32/137 (23%)
OMS1NP_010602.3 Methyltransf_25 245..355 CDD:404528 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.