DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and PRMT10

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_563720.1 Gene:PRMT10 / 839393 AraportID:AT1G04870 Length:383 Species:Arabidopsis thaliana


Alignment Length:350 Identity:114/350 - (32%)
Similarity:182/350 - (52%) Gaps:44/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 GSDQSVPRNNVCLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGI 256
            |...|.|.:......:||.:|:......:||||:||...|..::.||:....||||||||.|:||
plant    19 GGGPSAPVDKEVDYAQYFCTYSFLYHQKDMLSDRVRMDAYFNAVFQNKHHFEGKTVLDVGTGSGI 83

  Fly   257 LSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGY 320
            |:|::::|||.:|..::.:.:...|..:::.|.::: ||:|:|.:||..||| |.|:||||||||
plant    84 LAIWSAQAGARKVYAVEATKMADHARALVKANNLDHIVEVIEGSVEDISLPE-KVDVIISEWMGY 147

  Fly   321 FLLYESMLDSIIYARENHLNPNGIILPSRCTLSLL----------------GYGDDTLYADEVEF 369
            |||.|||.||:|.||:..|.|.|::.||...:.|.                ...|...::||:: 
plant   148 FLLRESMFDSVISARDRWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMADWHNFSDEIK- 211

  Fly   370 WSNVYEVDMSDLRKQSIEE--------PLMQVVDAEFMLTEPEQIANFDIMTVDMN-----YPNF 421
              :.|.|||..|.|...||        .:...::.:.::..|..:...|.:|..::     ..|.
plant   212 --SYYGVDMGVLTKPFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTASVSEIEEVRSNV 274

  Fly   422 THQFSLKVTKPGRLSAFVGYFETLF----ELPS--PVMFSTSPSATP-THWKQTVFFIENPQVVK 479
            |...:::.|   ||..|.|:|:..|    |.|:  .:..:|:||... |||.|.||.:.||..|:
plant   275 TSVINMEHT---RLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHWGQQVFIMSNPINVE 336

  Fly   480 EGDVICGKITSRRHKEDVRGLSVDI 504
            |||.:...:...|.||:.|.:.:::
plant   337 EGDNLNLGLLMSRSKENHRLMEIEL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 52/103 (50%)
PRMT10NP_563720.1 Methyltransf_25 74..170 CDD:379312 48/96 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.