DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Art3 and Alkbh8

DIOPT Version :9

Sequence 1:	NP_650434.1	Gene:	Art3 / 41837	FlyBaseID:	FBgn0038306	Length:	516	Species:	Drosophila melanogaster
Sequence 2:	XP_006509942.1	Gene:	Alkbh8 / 67667	MGIID:	1914917	Length:	709	Species:	Mus musculus

Alignment Length:	140	Identity:	29/140 - (20%)
Similarity:	49/140 - (35%)	Gaps:	43/140 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   153 QQRIAEQSQLLQQANEDMERMRNDYKALLQKVHADGEPKGSDQSVPRNNVCLDNEYFKSYAHFGI 217
            :||.|....|.:.:.|.:|         |::.|                  :...|.:..:||
Mouse   396 RQRKATPPSLTESSKEALE---------LEQKH------------------VHQVYNEIASHF-- 431

  Fly   218 HHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTG-ILSIFASKAGAARVVGIDNSDIVYTA 281
                  ...|.|.:...:...:|:..|..|.|:|||.| .|.|...    ..::|.|.|.   ..
Mouse   432 ------SSTRHSPWPRIVEFLKALPSGSIVADIGCGNGKYLGINKD----LYMIGCDRSQ---NL 483

  Fly   282 MDIIRKNKVE 291
            :||.|:.:.:
Mouse   484 VDICRERQFQ 493

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Art3	NP_650434.1	Methyltransf_18	243..346	CDD:289607	15/50 (30%)
Alkbh8	XP_006509942.1	DUF1891	46..82	CDD:117570
		RRM_ALKBH8	87..167	CDD:240877
		2OG-FeII_Oxy	197..379	CDD:389772
		Methyltransf_25	455..542	CDD:379312	14/46 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900