Sequence 1: | NP_650434.1 | Gene: | Art3 / 41837 | FlyBaseID: | FBgn0038306 | Length: | 516 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074940.1 | Gene: | Mettl7a3 / 668178 | MGIID: | 3710670 | Length: | 244 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 45/206 - (21%) |
---|---|---|---|
Similarity: | 61/206 - (29%) | Gaps: | 85/206 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 SLLQNEAVVRGK-TVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKVENVE--L 295
Fly 296 IKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSL------ 354
Fly 355 ----------LGYGDDTLYADEV------------------------------EFWSNVYEVDMS 379
Fly 380 DLRKQSIEEPL 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art3 | NP_650434.1 | Methyltransf_18 | 243..346 | CDD:289607 | 25/105 (24%) |
Mettl7a3 | NP_001074940.1 | Methyltransf_11 | 75..172 | CDD:285453 | 28/132 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |