DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and mettl7a.1

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001073508.1 Gene:mettl7a.1 / 569131 ZFINID:ZDB-GENE-061027-239 Length:242 Species:Danio rerio


Alignment Length:222 Identity:42/222 - (18%)
Similarity:83/222 - (37%) Gaps:69/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 HHEMLSDKVRTSTYRASLLQN-------EAVVRGKTVLDVGCGTGILSIFASKAGAARVVGID-- 273
            :::.::||.|      .|.:|       :..:|   :|:||||:|  :.|......:::...|  
Zfish    46 YNDKMNDKKR------ELFRNLDRFYPSKGSLR---ILEVGCGSG--ANFEHYPTGSKITCTDPN 99

  Fly   274 -------------NSDIVYTAMDIIRKNKVENVE----------LIKGRLEDTD--LPETKYDII 313
                         |..:||.:..:.....::.||          |:...::||:  |.|.|.  :
Zfish   100 PHFKKYLEKSMEKNEHLVYDSFIVASGENLQAVEDSSVDAVVCTLVLCSVKDTNKVLQEAKR--V 162

  Fly   314 ISEWMGYFLLYESMLD--SIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEV 376
            :.....:|.|...:.|  :.:|..::.|.|         .....|.|.:|....    |.::...
Zfish   163 LRPGGAFFFLEHVVSDPSTWVYFFQHVLQP---------FWYFFGDGCETTRTT----WKDIDAA 214

  Fly   377 DMSDLRKQSIEEPLMQVVDAEFMLTEP 403
            ..||::.:.|:.||       |.:.:|
Zfish   215 GFSDVKLRHIQAPL-------FFMIKP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 26/131 (20%)
mettl7a.1NP_001073508.1 Methyltransf_11 74..171 CDD:369777 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.