Sequence 1: | NP_650434.1 | Gene: | Art3 / 41837 | FlyBaseID: | FBgn0038306 | Length: | 516 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021327508.1 | Gene: | mettl7a.2 / 569089 | ZFINID: | ZDB-GENE-120215-62 | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 231 | Identity: | 43/231 - (18%) |
---|---|---|---|
Similarity: | 80/231 - (34%) | Gaps: | 92/231 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 218 HHEMLSDKVRTSTYRASLLQN-------EAVVRGKTVLDVGCGTGILSIFASKAGAARVVGID-- 273
Fly 274 -------------NSDIVYTAMDIIRKNKVENVE----------LIKGRLEDTD--LPETK---- 309
Fly 310 -------YDIIISE---WMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYA 364
Fly 365 DEVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFML 400 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art3 | NP_650434.1 | Methyltransf_18 | 243..346 | CDD:289607 | 25/143 (17%) |
mettl7a.2 | XP_021327508.1 | Methyltransf_11 | 74..171 | CDD:311935 | 18/98 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |