DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and PRMT8

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_062828.3 Gene:PRMT8 / 56341 HGNCID:5188 Length:394 Species:Homo sapiens


Alignment Length:307 Identity:136/307 - (44%)
Similarity:199/307 - (64%) Gaps:6/307 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 YFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGI 272
            ||.||||||||.|||.|:|||.|||.|:..|:.|.:.|.|||||.||||||:||:||||.:|.||
Human    76 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI 140

  Fly   273 DNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARE 336
            :.|.|...:..||:.|.::| :.:.||::|:.:||..|.||||||||||.|.|||||:::|:||:
Human   141 ECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARD 205

  Fly   337 NHLNPNGIILPSRCTLSLLGYGDDTLYAD-EVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFML 400
            ..|.|.|::.|.|..|.::.. :|..|.| ::.:|.|||..||:.:|..:::|||:.:||.:.::
Human   206 KWLKPGGLMFPDRAALYVVAI-EDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVV 269

  Fly   401 TEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLF-ELPSPVMFSTSPSATPTH 464
            |....|...||.||.....:||..|.|::.:...:.|.|.||...| :....:.|||:|.|..||
Human   270 TNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTH 334

  Fly   465 WKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGL--SVDIEVFGK 509
            ||||||::|:...|:.|:.|.|.|:.:.:.::||.|  :||::..|:
Human   335 WKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 55/103 (53%)
PRMT8NP_062828.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..40
SH3-binding 1. /evidence=ECO:0000269|PubMed:17925405 29..42
SH3-binding 2. /evidence=ECO:0000269|PubMed:17925405 53..58
AdoMet_MTases 115..215 CDD:100107 54/99 (55%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000305|PubMed:26529540, ECO:0000305|PubMed:26876602, ECO:0007744|PDB:4X41, ECO:0007744|PDB:5DST 119..122 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7482
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.