DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and alkbh8

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_009290865.1 Gene:alkbh8 / 556362 ZFINID:ZDB-GENE-100922-251 Length:666 Species:Danio rerio


Alignment Length:291 Identity:65/291 - (22%)
Similarity:99/291 - (34%) Gaps:82/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EDEYDDID-DDDEPMDEG-----DE-LTTCLFCTETSANISVAIDHLDARHKVNLSQLQRKF--E 85
            |..||:.: |.|:|:..|     |. |..||    ...:|||..|.|    .||..|..:..  .
Zfish   179 EFRYDNNNVDKDKPLPGGLPVECDALLQRCL----AGGHISVLPDQL----TVNQYQSGQGIPPH 235

  Fly    86 MDQYSFIKLINYIRAKKISAEQLLSAEHP----------------LWQDEKYLQPGEYEPWLCYD 134
            :|.:|..:  :.|.:..:.|:.::..:||                :..:.:||......|.....
Zfish   236 VDTHSPFE--DTILSLSLGAKTVMDFKHPDGRSVAVVLPERSLLVMKGESRYLWTHGITPRKFDV 298

  Fly   135 YEVLKTDGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRNDYKALLQKVH-----------ADG 188
            ..|.:|.|:....|.|               :|..:.|.........:|:.           .|.
Zfish   299 VPVSETGGSGVMTSDL---------------SNLTLSRRDTRTSLTFRKIRHTPCNCAYPSVCDS 348

  Fly   189 EPKGSDQSVP--RNNVC-LDNEYFKSY-----AHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGK 245
            :...|...||  ..:.| |:::|....     :||.........|||.     .||   ::..|.
Zfish   349 QRPPSPPVVPVAEGDACRLESQYVHQVYEEISSHFSSTRHSPWPKVRD-----FLL---SLPPGS 405

  Fly   246 TVLDVGCGTG-ILSIFASKAGAARVVGIDNS 275
            .:.|||||.| .|.|    ..|.|.||.|.|
Zfish   406 FLADVGCGNGKYLGI----NPAVRAVGCDRS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 15/34 (44%)
alkbh8XP_009290865.1 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 130..300 CDD:304390 28/130 (22%)
Methyltransf_11 409..498 CDD:285453 14/28 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.