DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and prmt9

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001124239.1 Gene:prmt9 / 553290 ZFINID:ZDB-GENE-080728-4 Length:859 Species:Danio rerio


Alignment Length:327 Identity:77/327 - (23%)
Similarity:144/327 - (44%) Gaps:72/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 HHEMLSDKVRTSTYRASLLQNEAVVRG-KTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVY-T 280
            |..||:|..|...|:.::  .:||..| .:|||:|.|||||.:.|..||||.|...:.|..:| .
Zfish   156 HFLMLNDHGRNHKYQLAI--KKAVEGGCSSVLDIGTGTGILGMCAKMAGAAEVYACELSKTMYEL 218

  Fly   281 AMDIIRKNKVEN-VELIKGRLEDTDLPE---TKYDIIISEWMGYFLLYESMLDSIIYARENHLNP 341
            |.:::..|.:.: ::::..:..|.::|:   .:..::::|.:...|..|.:::::|:|.::.|.|
Zfish   219 ACEVLSANGMADCIKILHRKSLDMEIPKDIPNRVSLVVTETVDAGLFGEGIIETLIHAWKHLLLP 283

  Fly   342 -------------NGIILPSRCTLSLLGYGDDTLYADEVE-----FWSNVYEVDMSDLRKQSIEE 388
                         .|.::|:..|:    :| ..:...|:.     ..|:|..:|:|.:.:  |..
Zfish   284 PPNPGELLSSPSQTGRVIPAGATV----FG-VAVQCPEIRRHHRLCVSSVGGLDLSAVGQ--IYS 341

  Fly   389 PLMQVVDAE------------------FMLTEPEQIANFDIMTVDMNYPNFTH----------QF 425
            |:..:.|.|                  ..||:|     |..:.:|.|  |...          |.
Zfish   342 PVSCLADTEDSTEPYTTERLSRLRGGYIQLTQP-----FTALDIDFN--NVQELEGLCSREVVQL 399

  Fly   426 SLKVTKPGRLSAFVGYFETLFELPSPVMFSTSPSATPTHWKQTVFFIENP-QVVKEGDVICGKIT 489
            .|.||:.|.|.|...:|:  ..|......||.|. ..|.|:|.::.:::. ..||.||.|..:::
Zfish   400 CLCVTQDGILDALAVWFQ--LHLDQDNHLSTGPQ-EETCWEQAIYPVQSTFNSVKRGDEILVEVS 461

  Fly   490 SR 491
            .:
Zfish   462 CK 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 30/121 (25%)
prmt9NP_001124239.1 TPR_11 72..135 CDD:290150
TPR repeat 72..98 CDD:276809
MAS20 <96..133 CDD:295844
TPR repeat 103..133 CDD:276809
AdoMet_MTases 151..>267 CDD:302624 32/112 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.