DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and PRMT6

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:321 Identity:114/321 - (35%)
Similarity:174/321 - (54%) Gaps:32/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARV 269
            |..|::.|:...:|.||::|:|||..||..:|:|.|.:|||||||||.||||||||.::|||.||
Human    44 DQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRV 108

  Fly   270 VGIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIY 333
            ..::.|.|...|.:::|.|.:|: |.::.|.:|..:||| :.|.|:||||||.||:||||.|:::
Human   109 YAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPE-QVDAIVSEWMGYGLLHESMLSSVLH 172

  Fly   334 ARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNV---YEVDMSDLR------KQSIEEP 389
            ||...|...|::||:...|.:....|..| ...:.|||.|   |.||||.|.      .....|.
Human   173 ARTKWLKEGGLLLPASAELFIAPISDQML-EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEI 236

  Fly   390 LMQVVDAEFMLTEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGR----------LSAFVGYFET 444
            ::|.:..|.:|..|::.|..::....:       :..|:....||          :..|..:|:.
Human   237 VVQGLSGEDVLARPQRFAQLELSRAGL-------EQELEAGVGGRFRCSCYGSAPMHGFAIWFQV 294

  Fly   445 LF---ELPSPVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSV 502
            .|   |...|::.||||....|||||.:.::..|..|::...:.|:||....:::.|.|.|
Human   295 TFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 53/103 (51%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
AdoMet_MTases 67..>200 CDD:418430 63/133 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.