DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and PRMT7

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_011521414.1 Gene:PRMT7 / 54496 HGNCID:25557 Length:714 Species:Homo sapiens


Alignment Length:346 Identity:82/346 - (23%)
Similarity:132/346 - (38%) Gaps:96/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EYFKSYAHFGIHHE--------MLSDKVRTSTYRASLLQNEAVVRGK------TVLDVGCGTGIL 257
            |:.:...|:..|.|        ||.||.|...|...:  ..||.|.|      .|||:|.|||:|
Human    16 EWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQGI--RAAVSRVKDRGQKALVLDIGTGTGLL 78

  Fly   258 SIFASKAGAARVVGIDNSDIVY----------TAMDIIRKN------KVEN---VELIKGRLEDT 303
            |:.|..|||         |..|          .|:.|:.||      ||.|   .|:..|  .:.
Human    79 SMMAVTAGA---------DFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVG--PEG 132

  Fly   304 DLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVE 368
            |:| .:.:|:::|.....|:.|..|.|..:|..:.:..|...:|.|.          |:||..||
Human   133 DMP-CRANILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRA----------TVYAQLVE 186

  Fly   369 -----FWSNVYEVDM-SDLRKQSIEEPLMQVVDAEFMLTEP-------EQIANFDIMTVDMNYPN 420
                 .|:.::.:.: :.|.:|.|..|    ||.|.....|       .|::..|...:....|.
Human   187 SGRMWSWNKLFPIHVQTSLGEQVIVPP----VDVESCPGAPSVCDIQLNQVSPADFTVLSDVLPM 247

  Fly   421 FTHQFSLKVTK-------------PGRLSAFVGYFETLFELPSPVMFSTSP---SATP------T 463
            |:..||.:|:.             .||....:.:::...:....:..:.:|   .:.|      .
Human   248 FSIDFSKQVSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSDPEEMQWRD 312

  Fly   464 HWKQTVFFIENPQVVKEGDVI 484
            ||.|.|:|:...:.|.:|..:
Human   313 HWMQCVYFLPQEEPVVQGSAL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 36/127 (28%)
PRMT7XP_011521414.1 AdoMet_MTases 37..>186 CDD:302624 49/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.