DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Prmt2

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001020315.1 Gene:Prmt2 / 499420 RGDID:1565519 Length:445 Species:Rattus norvegicus


Alignment Length:427 Identity:138/427 - (32%)
Similarity:219/427 - (51%) Gaps:47/427 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AEHPLWQDEKYLQPGEYEPWLCYDYEV-LKTDGAPTQPSVLELQQR----IAEQSQLLQQANED- 169
            ||.|  ..|..:.|...|..:.|..|: |..|||..|   |:||..    ||:.:     |.:: 
  Rat     5 AEDP--SHESQVTPAPEEDPVDYGCEMQLLQDGAQLQ---LQLQPEEFVAIADYT-----ATDET 59

  Fly   170 -MERMRNDYKALLQKVHAD---GEPKGSDQSVPRNNV------------CLDNEYFKSYAHFGIH 218
             :..:|.:...:|::..||   ||..|....:|.|::            ..|.|||.||....:|
  Rat    60 QLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHLGKQVEEYDPEDTWQDEEYFDSYGTLKLH 124

  Fly   219 HEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIF-ASKAGAARVVGIDNSDIV-YTA 281
            .|||:|:.||:.|.:.:|||:..::.|.:|||||||||:|:| |..|....|..::.||:. :|.
  Rat   125 LEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTG 189

  Fly   282 MDIIRKNKVENVELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIIL 346
            ..:::....:.:.:.:.::||..||| |.|:::|||||..||:|.|::||:|||:..|..:|||.
  Rat   190 QLVLQNGFADTITVFQQKVEDVVLPE-KVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGIIW 253

  Fly   347 PSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIEEPLMQ-----VVDAEFMLTEPEQI 406
            |:...|.|:....:..|..:|.||.|.||.::|.|:..:|:|...:     ::..|..|:||..|
  Rat   254 PTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTI 318

  Fly   407 ANFDIMTVDM-NYPNFTHQFSLKVTKPGRLSAFVGYFETLFE-----LPSPVMFSTSPSATPTHW 465
            ...|:.||.: :......:....:.|.|.|..|..:|...|:     .|..|: ||.|....|||
  Rat   319 LQLDMRTVQVSDLETMRGELRFDIQKAGTLHGFTAWFSVHFQSLEEGQPQQVL-STGPLHPTTHW 382

  Fly   466 KQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSV 502
            |||:|.:::|..|..|||:.|.:..:|:....|.:||
  Rat   383 KQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 42/104 (40%)
Prmt2NP_001020315.1 SH3_PRMT2 46..98 CDD:212740 12/56 (21%)
AdoMet_MTases 153..253 CDD:100107 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.