DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and prmt6

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001157460.2 Gene:prmt6 / 448867 ZFINID:ZDB-GENE-040914-7 Length:355 Species:Danio rerio


Alignment Length:327 Identity:121/327 - (37%)
Similarity:189/327 - (57%) Gaps:24/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARV 269
            |..||.||:...||.||::|.|||:|||..:.:|...:.||.|||||.|||:||:|.::|||.:|
Zfish    23 DYMYFDSYSDVTIHEEMIADTVRTNTYRMGIFKNSKSIEGKVVLDVGAGTGVLSLFCAQAGARKV 87

  Fly   270 VGIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIY 333
            ..::.|.|...|:.|::.|::|: :|:||..||..:|.| |.|:|:||||||.||:||||:|:|:
Zfish    88 YAVEASSIADQAVKIVKLNQMEDRIEVIKSTLETIELAE-KVDVIVSEWMGYALLHESMLNSVIF 151

  Fly   334 ARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNV---YEVDMS---DLRKQSI--EEPL 390
            ||:..|.|.|:|||||..|.:... :|.:....::|||.|   |.||||   |..::.|  ::..
Zfish   152 ARDKWLKPGGLILPSRADLYIAPI-NDVVVEGRLDFWSTVKGQYGVDMSCMTDFARKCIMNKDIT 215

  Fly   391 MQVVDAEFMLTEPEQIANFDIMTV------DMNYPNFTHQFSLKVTKPGRLSAFVGYFETLFEL- 448
            :..|..|.:|:.|.:.|..|:.||      |:|     ..||........:.||..:|...|.. 
Zfish   216 VNPVTVEDVLSHPCKFAELDLNTVTLEQLRDVN-----GSFSCVCFGSSSIHAFCVWFTVTFPAE 275

  Fly   449 PSPVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSVDIE-VFGKKHK 512
            ...::.||||....|||||.|.::::...|.:...:.|:|:....:|:.|.:.:.:: |.|::.|
Zfish   276 EKALVLSTSPFKAETHWKQAVLYLDDAVDVMQDTKVEGEISLYPSEENSRHICIRVDYVIGEQKK 340

  Fly   513 YN 514
            ::
Zfish   341 HS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 52/103 (50%)
prmt6NP_001157460.2 AdoMet_MTases 50..>175 CDD:302624 60/125 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.