DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and prmt1

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_012821800.1 Gene:prmt1 / 448086 XenbaseID:XB-GENE-484022 Length:369 Species:Xenopus tropicalis


Alignment Length:307 Identity:143/307 - (46%)
Similarity:200/307 - (65%) Gaps:6/307 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 YFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGI 272
            ||.||||||||.|||.|:|||.|||.|:..|..:.:.|.|||||.|||||.:||:||||.:|:||
 Frog    51 YFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGI 115

  Fly   273 DNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARE 336
            :.|.|...|:.|::.||::: |.:|||::|:.:||..|.||||||||||.|.|||||:::||||:
 Frog   116 ECSSISDYAIKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIYARD 180

  Fly   337 NHLNPNGIILPSRCTLSLLGYGDDTLYAD-EVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFML 400
            ..|.|:|:|.|.|.||.:... :|..|.| ::.:|.|||..|||.::..:|:|||:.|||.:.::
 Frog   181 KWLTPDGLIFPDRATLYVTAI-EDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLV 244

  Fly   401 TEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLF-ELPSPVMFSTSPSATPTH 464
            |....|...||.||.::...||..|.|:|.:...:.|.|.||...| .......|||||.:..||
 Frog   245 TNACLIKEVDIYTVKVDDLTFTSPFCLQVKRNDYIHALVAYFNIEFTRCHKRTGFSTSPESPYTH 309

  Fly   465 WKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGL--SVDIEVFGK 509
            ||||||::|:...||.|:.|.|.|:.:.:.::.|.|  :|||:..|:
 Frog   310 WKQTVFYMEDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDIDFKGQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 57/103 (55%)
prmt1XP_012821800.1 AdoMet_MTases 90..190 CDD:100107 56/99 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.