DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and carm1

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001003645.1 Gene:carm1 / 445251 ZFINID:ZDB-GENE-040724-77 Length:588 Species:Danio rerio


Alignment Length:459 Identity:129/459 - (28%)
Similarity:219/459 - (47%) Gaps:65/459 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YSFIKLINYIRA----KKISAEQLLSAEHPLWQDEKYLQPGEYEPWLCYDYEVLKTDGAPTQPSV 149
            :|.::|::...|    ::.|.:|.|..|..:.||...:.....|....:...||:    .|:.| 
Zfish     6 FSGVRLLSIGDANGDIQRHSEQQPLRLEIKMNQDAAQIILSNNEETCVFKCTVLR----ETECS- 65

  Fly   150 LELQQRIAEQ---------SQLLQQANEDMERMRNDYKALLQKVHADGEPKGSDQSV--PRNNVC 203
                 |:.:|         |.|||.|:.      .|:.:....:......|| |:||  .|....
Zfish    66 -----RVGKQSFIITLGCNSVLLQFASP------ADFSSFYNLLKICRGQKG-DRSVFSDRTEES 118

  Fly   204 LDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAAR 268
            ...:||:.|.:......|:.|.|||.||:.::|||....:.|.|||||||:||||.||::|||.:
Zfish   119 SAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKVVLDVGCGSGILSFFAAQAGARK 183

  Fly   269 VVGIDNSDIVYTAMDIIRKNKV-ENVELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSII 332
            |..::.|.:...|..::..|:: |.|.:|.|::|:..||| :.||||||.|||.|..|.||:|.:
Zfish   184 VYAVEASTMAQHAEVLVNSNRLSERVVVIPGKVEEVSLPE-QVDIIISEPMGYMLFNERMLESYL 247

  Fly   333 YARENHLNPNGIILPSRCTLSLLGYGDDTLYADE---VEFW--SNVYEVDMSDLRKQSIEE---- 388
            :|:: .|.|:|.:.|:...:.|..:.|:.||.::   ..||  .:.:.||:|.||..:::|    
Zfish   248 HAKK-FLKPSGKMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQ 311

  Fly   389 PLMQVVDAEFMLTEP-EQIANF------DIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLF 446
            |::...|...::.:. :...||      |:..:::       .|...:...|.:.....:|:..|
Zfish   312 PIVDTFDIRILMAKSVKYTVNFLEAKEEDLYKIEI-------PFKFHMMHSGLVHGLAFWFDVAF 369

  Fly   447 ELPS--PVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGK---ITSRRHKEDVRGLSVDIEV 506
             :.|  .|..||:|:...|||.|....:::|...|.||.:.|.   |.::|...|: .:...::.
Zfish   370 -IGSVMTVWLSTAPTEPLTHWYQVRCLLQSPLFAKAGDTMSGTALLIANKRQSYDI-SIVAQVDQ 432

  Fly   507 FGKK 510
            .|.|
Zfish   433 TGSK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 47/103 (46%)
carm1NP_001003645.1 CARM1 8..112 CDD:288395 26/120 (22%)
PRMT5 <146..409 CDD:282971 86/272 (32%)
AdoMet_MTases 162..263 CDD:100107 47/102 (46%)
Transactivation domain. /evidence=ECO:0000250 473..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.