DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Art6

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster


Alignment Length:311 Identity:121/311 - (38%)
Similarity:186/311 - (59%) Gaps:13/311 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARV 269
            |::||:||:....|..||.|.||...:|.:::|:..:.:.|.||||||||||||:||::|||::|
  Fly    16 DSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGASKV 80

  Fly   270 VGIDNSDIVYTAMDIIRKNKVEN-VELIKGRLEDTDLPE--TKYDIIISEWMGYFLLYESMLDSI 331
            :.::.:||...|.:|||.|:.|| |:::||.:|..:||:  .|.|||:|||||..|..|:|::|:
  Fly    81 IAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSV 145

  Fly   332 IYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIEEPLMQVVDA 396
            ::||:..|...|.||||...|.|:| ..|......:.||.||..:||..:||...:|||::.|..
  Fly   146 LFARDKWLTRGGRILPSTGNLWLMG-AYDPHRRTNLNFWCNVEGIDMGCVRKPFSQEPLVEFVPI 209

  Fly   397 EFMLTEPEQIANFDIMTVDMNYP-NFTHQFSLKVTKPGRLSAFVGYFETLFELPS-----PVMFS 455
            :.:||: |...:...:.|..|.| .|...|.|||.:.|.::..|.||:.||  ||     .|..:
  Fly   210 QQLLTD-ECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINMLVLYFDVLF--PSGKSNKSVSLT 271

  Fly   456 TSPSATPTHWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSVDIEV 506
            |||.:..|||:|||..::.|..|:..|.:.|.:......:|.||::.|:.:
  Fly   272 TSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRGMNFDLHI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 51/105 (49%)
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 60/131 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450652
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.