DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and CG10903

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster


Alignment Length:276 Identity:61/276 - (22%)
Similarity:102/276 - (36%) Gaps:97/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 KTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKVENVELIKGRLEDTDLPETK 309
            :.:||:|||:|:       :|:.    :::|:.::..:||           .|..|:.....|..
  Fly    53 RLILDIGCGSGL-------SGSV----LEDSEHMWIGIDI-----------SKSMLDIAVEREVA 95

  Fly   310 YDIIISEWMGYFLLYE----------SMLDSIIYARENHLNPNGIILPSRCTL-SLLGYGDDTLY 363
            .|:|:.: ||..:.::          |.|..:..|.:::.||:..:|....|| |.|     |..
  Fly    96 GDVILGD-MGEGMPFKPGTFDGAISISALQWLCNADKSYHNPHKRLLKFFTTLFSCL-----TRT 154

  Fly   364 ADEV-EFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTEPEQIANFDIMTVDMNYPNFTHQFSL 427
            |..| :|:.     :.||    .||....|.:.|.|          :..:.||  |||     |.
  Fly   155 ARAVFQFYP-----ENSD----QIEMVTSQAMKAGF----------YGGLVVD--YPN-----SA 193

  Fly   428 KVTKPGRLSAFVGYFETLF-----ELPSPVMFSTSPSATPTHWKQTVFFIENPQVVKEG------ 481
            |..|         |:..|.     |||..:   .||..     ::.|.:|:.....:|.      
  Fly   194 KAKK---------YYLVLMTGGSAELPQAL---GSPEE-----ERRVNYIKKRDACREARGKAPK 241

  Fly   482 ---DVICGKITSRRHK 494
               |.|..|...||.:
  Fly   242 KSRDWILAKKERRRRQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 22/110 (20%)
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 22/108 (20%)
WBS_methylT 202..272 CDD:289366 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.