DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Art7

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster


Alignment Length:331 Identity:76/331 - (22%)
Similarity:134/331 - (40%) Gaps:65/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVR--GKT--VLDVGCGTGILSIFASKAG 265
            |.:|....|:.|. .:||.|..|...|.|:|.:..|.:|  |:.  |||:|.||||||:.|..||
  Fly    23 DYDYHLEVANAGF-GDMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAG 86

  Fly   266 AARVVGIDN-SDIVYTAMDIIRKNKV-ENVELIKGRLED----TDLPETKYDIIISEWMGYFLLY 324
            |..|...:. ..:...|..|:..|.. :.|.||:.|..:    .|:|. |.:::::|.:...|:.
  Fly    87 ADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPR-KANLLVAELLDTELIG 150

  Fly   325 ESMLDSIIYARENHLNPNGIILPSRC-------------------TLSLLGYGDDTLYADEVEFW 370
            |..:....:|....|..:.:.:|:|.                   |::.|. |:..|:..| :..
  Fly   151 EGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLAAQWNSLKTIANLD-GEPLLHPPE-QLK 213

  Fly   371 SNVYEVDMSDLRKQSIEEPLMQVVDAEFM-LTEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGR 434
            |...|..:.|::       |.|:..:.|. ||:|.:|..||...........:....|:..:||.
  Fly   214 SCQGEAALHDVQ-------LSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGA 271

  Fly   435 LSAFVGYFETLFELPSPVMFSTS---------------------PSATP--THWKQTVFFIENP- 475
            ......:::...:....::.|.:                     |:..|  .||.|.:::|..| 
  Fly   272 AELVFYWWDIQLDDDGEILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAIYYIPKPL 336

  Fly   476 QVVKEG 481
            |:::.|
  Fly   337 QLLEAG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 32/112 (29%)
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 42/150 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.