DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Prmt7

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001014175.1 Gene:Prmt7 / 361402 RGDID:1304869 Length:693 Species:Rattus norvegicus


Alignment Length:346 Identity:81/346 - (23%)
Similarity:135/346 - (39%) Gaps:94/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EYFKSYAHFGIHHE--------MLSDKVRTSTYRASLLQNEAVVRGK----TVLDVGCGTGILSI 259
            |:.:...|:..|.|        ||.||.|...|...:....:.|:.|    .|||:|.|||:||:
  Rat    16 EWLEEDEHYDYHQEIARSSYADMLHDKDRNIKYYQGIRAAVSRVKDKGQKALVLDIGTGTGLLSM 80

  Fly   260 FASKAGAARVVGIDNSDIVY----------TAMDIIRKN------KVEN---VELIKGRLEDTDL 305
            .|..|||         |..|          .|:.|:.||      ||.|   .|:..|  .|.||
  Rat    81 MAVTAGA---------DFCYAVEVFKPMAEAAVKIVEKNGFSDKIKVINKHSTEVTVG--PDGDL 134

  Fly   306 PETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVE-- 368
            | .:.:|:::|.....|:.|..|.|..:|.::.:..:...:|.|.          |:||..||  
  Rat   135 P-CRANILVTELFDTELIGEGALPSYEHAHKHLVQEDCEAVPHRA----------TVYAQLVESK 188

  Fly   369 ---FWSNVYEVDM-SDLRKQSIEEP--------LMQVVDAEFMLTEPEQIANFDIMTVDMNYPNF 421
               .|:.::.|.: :.|.:|.|..|        ...|.|.:.....|   |:|.::: |: .|.|
  Rat   189 RMWSWNKLFPVRVQTGLGEQLIIPPSELERCPGAPSVYDIQLNQVSP---ADFTVLS-DV-LPMF 248

  Fly   422 THQFSLKVTK-------------PGRLSAFVGYFETLFELPSPVMFSTSPSATPT---------H 464
            :..||.:|:.             .|:....:.:::...:....:..:.:|....|         |
  Rat   249 SVDFSKQVSSSAACHSKQFVPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAQTDPQELQWRDH 313

  Fly   465 WKQTVFFIENPQVVKEGDVIC 485
            |.|.|:|:...:.:.:|...|
  Rat   314 WMQCVYFLPQEEPIMQGSPRC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 36/125 (29%)
Prmt7NP_001014175.1 AdoMet_MTases 37..>188 CDD:302624 50/172 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.