DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and CG10428

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster


Alignment Length:331 Identity:70/331 - (21%)
Similarity:120/331 - (36%) Gaps:96/331 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PGEYEPWLCYDYEVLKTDGAPTQP------SVLELQQRIAEQSQLLQQANEDMERMRN----DYK 178
            |||.....|....:.|.|....:|      |.|||:..:::.|.|..|.|.|.|....    |::
  Fly   285 PGELGIPDCEATSLYKADPKRYKPRNRIYTSQLELEAALSKLSSLQLQFNSDSEHTYGQQLIDWE 349

  Fly   179 ALLQKVHADGE--PKGSDQSVPRNNVCLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAV 241
            . ::..||...  ||   :.:.|....|:|               |::.|      .||.|    
  Fly   350 Q-IEPTHAKSSALPK---ERLERKRQQLEN---------------LANAV------VSLAQ---- 385

  Fly   242 VRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKVENVELIKGRLEDTDLP 306
             .|..::|...|||.|:|..:       :.:.|..|      |:.:||.  ..|::.:....:|.
  Fly   386 -PGDRIVDFCSGTGHLAILLA-------LKLPNCTI------IVMENKA--FSLLQAQKRSNELG 434

  Fly   307 ETK---YDIIISEWMGYFLLYESM-----LDSIIYARENHLNPNGIILPSRCTLSL-----LGY- 357
            .|.   |...|..::|.|.:..|:     ...|:..:......:.:..|. |..||     :.| 
  Fly   435 LTNCVFYQCNIDYFVGGFKIGASLHACGTATDIVLQQCRRAKAHFVCCPC-CYGSLQPMPHISYP 498

  Fly   358 ----------GDDTLY----ADEVEFWSNVYEVDMSDLRKQSIEEPL--MQVVDAEFMLTEPEQI 406
                      ..|.||    ||:      .:|:..::.:.::..:.|  |.|||.:.:|...|  
  Fly   499 LSKAFQKVLDTKDYLYIAHSADQ------AHEMGTTNCKPETTLQGLHCMSVVDTDRLLQAEE-- 555

  Fly   407 ANFDIM 412
            |.:.::
  Fly   556 AGYQVI 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 21/110 (19%)
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 30/159 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.