DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Art8

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster


Alignment Length:316 Identity:107/316 - (33%)
Similarity:171/316 - (54%) Gaps:24/316 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVV 270
            |.||..|.:..||..||.|:.|...|..::|.|:.:.:.|.|:|||.||||||.|.:||||..|.
  Fly     3 NTYFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVY 67

  Fly   271 GIDNSDI-VYTAMDIIRKNKVEN-VELIKGRLEDTDLP--ETKYDIIISEWMGYFLLYESMLDSI 331
            .::.|:: ...|:|:|..|.:.| |::|:.|:|:..||  ..|.|||:|||||::||:|.||||:
  Fly    68 AVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSV 132

  Fly   332 IYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMS----DLRKQSIEEPLMQ 392
            :.||:..|...|::.||.||:.:......:|:.|    |.||..:.|.    .||.|....|.:.
  Fly   133 LLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPEIT 193

  Fly   393 VVDAEFMLTEP---EQIANFDIMTVDMNYPNFTHQFSLKVT--KPGRLSAFVGYFETLFELPSPV 452
            .::.:.:|.|.   ..:...|:...|::    :.||...:|  |.|....|..:|:..|. ....
  Fly   194 QLNPQDLLHEGVVFHWMNLLDVEASDLD----SIQFKEVITAQKAGNHQGFCIWFDVQFP-GEDF 253

  Fly   453 MFSTSPSATPTHWKQTVFFI--ENPQVVKEGDVICGKITSRRHKEDVRGLSVDIEV 506
            :.||||.:.||||||.|..:  |:.:.::|...|..:||.:|...|:|..::::::
  Fly   254 VLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 49/106 (46%)
Art8NP_609478.1 SmtA 1..244 CDD:223574 86/248 (35%)
Methyltransf_18 40..147 CDD:289607 49/106 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.