DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and PRMT2

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001526.2 Gene:PRMT2 / 3275 HGNCID:5186 Length:433 Species:Homo sapiens


Alignment Length:405 Identity:127/405 - (31%)
Similarity:208/405 - (51%) Gaps:38/405 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GEYEPWLCYDYEVLKTDGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRNDYKALLQKVHAD-- 187
            || ||..|.:..:|: :|...:..|........:::||        ..:|.:...:|::..||  
Human    14 GE-EPAECSEAGLLQ-EGVQPEEFVAIADYAATDETQL--------SFLRGEKILILRQTTADWW 68

  Fly   188 -GEPKGSDQSVPRNNV------------CLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNE 239
             ||..|....:|.|:|            ..|.|||.||....:|.|||:|:.||:.|.:.:|||:
Human    69 WGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNK 133

  Fly   240 AVVRGKTVLDVGCGTGILSIFASKAGAARVV-GIDNSDIV-YTAMDIIRKNKVENVELIKGRLED 302
            ..:..|.:|||||||||:|:|.:.....|.| .::.|::. :|...:::....:.:.:.:.::||
Human   134 ESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVED 198

  Fly   303 TDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEV 367
            ..||| |.|:::|||||..||:|.|::||:|||:..|..:|:|.|:...|.|:....|..|..:|
Human   199 VVLPE-KVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKV 262

  Fly   368 EFWSNVYEVDMSDLRKQSIEE-----PLMQVVDAEFMLTEPEQIANFDIMTVDM-NYPNFTHQFS 426
            .||.|.||.::|.|:..:::|     ....::..|..|:||..|...|:.||.: :......:..
Human   263 LFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELR 327

  Fly   427 LKVTKPGRLSAFVG----YFETLFELPSPVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGK 487
            ..:.|.|.|..|..    :|::|.|...|.:.||.|....||||||:|.:::|..|..|||:.|.
Human   328 FDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGS 392

  Fly   488 ITSRRHKEDVRGLSV 502
            :..:|:....|.:||
Human   393 VVLQRNPVWRRHMSV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 39/104 (38%)
PRMT2NP_001526.2 Interaction with ESR1 1..277 89/273 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 4/6 (67%)
SH3_PRMT2 34..86 CDD:212740 13/59 (22%)
Interaction with RB1. /evidence=ECO:0000250 83..207 40/124 (32%)
AdoMet_MTases 110..>169 CDD:302624 25/58 (43%)
Interaction with ESR1 133..275 51/142 (36%)
AdoMet_MTases 141..241 CDD:100107 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.