DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and Trmt9b

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001371028.1 Gene:Trmt9b / 319582 MGIID:2442328 Length:447 Species:Mus musculus


Alignment Length:314 Identity:54/314 - (17%)
Similarity:93/314 - (29%) Gaps:133/314 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LQNEAVVR----------GKTVLDVGCGTG-------------------ILSIFASKAGAARVVG 271
            ||::|..|          |..|.|:|||||                   ::.|..::  ...|:.
Mouse    27 LQSKAWPRVRQFLQDQKPGSLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNR--GCEVMV 89

  Fly   272 IDNSDIVY--------TAMDIIR--KNKVENVELIK---------GRL-------EDTDLPETKY 310
            .||.::.:        .::.:|.  ..|...:..||         |:|       |..:....|.
Mouse    90 CDNLNLPFRDQGFDAIISIGVIHHFSTKERRIRAIKEMARVLAPGGQLMIYVWAMEQKNRRFEKQ 154

  Fly   311 DIII---------------SEW------------------MGYFLLYESMLDSIIYARENHLNPN 342
            |:::               ..|                  .|..:.::...||    :.:|....
Mouse   155 DVLVPWNRALCSRLLSESHQSWGHHCEHPRSRGFQGPGSVCGCAVCFKGRCDS----KRSHSMDY 215

  Fly   343 GIILPSRC--TLSLLGYGDDTLYAD---EVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTE 402
            |..:...|  .:|..|..::.||::   ....|.....:|.|.||||......|::         
Mouse   216 GSAVARTCCEAISKEGERENGLYSNFGKSFRSWFFSRSLDESTLRKQIERVRPMKI--------- 271

  Fly   403 PEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLFELPSPVMFST 456
            ||..||..:......:|:                         .:|.:|..|||
Mouse   272 PEAWANSTVSQQPSRHPS-------------------------LDLHAPEPFST 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 28/190 (15%)
Trmt9bNP_001371028.1 Methyltransf_25 48..135 CDD:404528 15/88 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..306 8/52 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.