Sequence 1: | NP_650434.1 | Gene: | Art3 / 41837 | FlyBaseID: | FBgn0038306 | Length: | 516 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001371028.1 | Gene: | Trmt9b / 319582 | MGIID: | 2442328 | Length: | 447 | Species: | Mus musculus |
Alignment Length: | 314 | Identity: | 54/314 - (17%) |
---|---|---|---|
Similarity: | 93/314 - (29%) | Gaps: | 133/314 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 LQNEAVVR----------GKTVLDVGCGTG-------------------ILSIFASKAGAARVVG 271
Fly 272 IDNSDIVY--------TAMDIIR--KNKVENVELIK---------GRL-------EDTDLPETKY 310
Fly 311 DIII---------------SEW------------------MGYFLLYESMLDSIIYARENHLNPN 342
Fly 343 GIILPSRC--TLSLLGYGDDTLYAD---EVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTE 402
Fly 403 PEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLFELPSPVMFST 456 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art3 | NP_650434.1 | Methyltransf_18 | 243..346 | CDD:289607 | 28/190 (15%) |
Trmt9b | NP_001371028.1 | Methyltransf_25 | 48..135 | CDD:404528 | 15/88 (17%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 274..306 | 8/52 (15%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 320..348 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |