powered by:
Protein Alignment Art3 and Antkmt
DIOPT Version :9
Sequence 1: | NP_650434.1 |
Gene: | Art3 / 41837 |
FlyBaseID: | FBgn0038306 |
Length: | 516 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120919.1 |
Gene: | Antkmt / 287150 |
RGDID: | 1306126 |
Length: | 222 |
Species: | Rattus norvegicus |
Alignment Length: | 46 |
Identity: | 14/46 - (30%) |
Similarity: | 25/46 - (54%) |
Gaps: | 5/46 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 233 ASLLQNE---AVVRGK--TVLDVGCGTGILSIFASKAGAARVVGID 273
||..|.| :::||: .::|:|.|.|.:.:.|.:.|....||.:
Rat 60 ASARQVENVLSLLRGRPGKMVDLGSGDGRIVLAAHQCGLRPAVGYE 105
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Art3 | NP_650434.1 |
Methyltransf_18 |
243..346 |
CDD:289607 |
10/33 (30%) |
Antkmt | NP_001120919.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.