DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and ETFBKMT

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001129335.1 Gene:ETFBKMT / 254013 HGNCID:28739 Length:262 Species:Homo sapiens


Alignment Length:105 Identity:32/105 - (30%)
Similarity:54/105 - (51%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAM----DIIRKNK----VE 291
            ||.|..|||||:|||:|.|.|..:|.|..:||:|::..|...|...|:    ::.|.|.    ::
Human   107 LLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCELNRLNPFPILIQ 171

  Fly   292 NVELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSI 331
            |:         .:|.:.|:|:::   :|.....|.:.||:
Human   172 NI---------LNLEQDKWDLVV---LGDMFYDEDLADSL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 27/97 (28%)
ETFBKMTNP_001129335.1 Nnt1 42..260 CDD:226413 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.