DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and R08F11.4

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_504052.1 Gene:R08F11.4 / 178797 WormBaseID:WBGene00019968 Length:354 Species:Caenorhabditis elegans


Alignment Length:288 Identity:59/288 - (20%)
Similarity:113/288 - (39%) Gaps:70/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IKLINYIRAKKISAEQLLSAEHPLWQDEKYLQPGEYEPWLCYDYEVLKTDGAPTQPSVLELQQRI 156
            |.:.|.:...|:.|| :.:||.|:..::...:.|      |.:..|.:.........:||:.:: 
 Worm    18 INIGNRLNFFKVIAE-ISNAECPVLPEKIAEKAG------CKERYVREWCNTLACGRILEVNEK- 74

  Fly   157 AEQSQLLQQANEDMERMRND-----YKALLQKVHADGEPKGSDQSVPRNNVCLDNEYFKSYAHFG 216
             |:..:   |||::|.:..:     :.::|..|     .|..|..:         |.||....:|
 Worm    75 -EEFWI---ANENLEALTTENFPLMFNSMLSTV-----LKPIDTLI---------ECFKKEGPYG 121

  Fly   217 IHHEMLSDKVRTSTYRASLLQNEAVV-----------------RGKTVLDVGCGTGILS-IFASK 263
            :.:...||..........::..:.::                 .|..|||||||.|..| :.|..
 Worm   122 LDYSAYSDFEEMQQKFTKIVHEKHIIPDLVPAIGNGIKEKLEAGGIRVLDVGCGGGFHSGLLAEH 186

  Fly   264 AGAARVVGIDNSDIVYTAMDIIRKN---KVENVELIKGRLEDTDLPETKYDIIISEWMGYF---L 322
            ...::.||:|.::....|..:.:|:   ..||:|.:   :.|.       .|:.|.|...|   :
 Worm   187 YPKSQFVGLDITEKAIKAARLKKKSDGTDFENLEFV---VADA-------AIMPSSWTDSFDLVI 241

  Fly   323 LYESMLDSI---IYARENH--LNPNGII 345
            |:.|..|.:   :...|.|  :.|:|::
 Worm   242 LFGSCHDQMRPDLCLLEVHRVVKPDGLV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 31/115 (27%)
R08F11.4NP_504052.1 Methyltransf_31 165..>281 CDD:316372 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.