DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and prmt-9

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001040990.1 Gene:prmt-9 / 178221 WormBaseID:WBGene00011939 Length:680 Species:Caenorhabditis elegans


Alignment Length:292 Identity:55/292 - (18%)
Similarity:112/292 - (38%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 HHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAM 282
            |..|::|..|...: |..|.:....|...|.|:|.||||||..|::.........:|..:...:.
 Worm   142 HIRMINDVKRNEAF-AKALNDTIKSRITVVFDIGSGTGILSAIAARKTNLVTALEENMCLTMISK 205

  Fly   283 DIIRKNKVENVELIKGRLEDTDLPET--KYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGII 345
            :::::|.||:  .:....:::...||  |.||::||.:...:..|.::::.:.|.....:...|.
 Worm   206 EVLKRNGVES--RVNVHAKNSTYFETCEKADIVVSETLDCCVFGEKIVETFLDAHVRFSHDRTIF 268

  Fly   346 LPSRCTLSLLGYGDDTLYADEVEFWSNV-YEVDMSDLRKQSIEEP-------------------L 390
            :|.:.|:.:..:....::....:.:..| |..:...:.:...|:|                   .
 Worm   269 IPHQATVYVRLFSCREIFDIHCQDYGGVRYRSEYVKIGESDAEQPYWCASAADYSQFELLSGSVA 333

  Fly   391 MQVVDAEFMLTEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLFELPSPVMFS 455
            |..||...:....:.:||.:...:........|.||:..|     |...|:.:.:.:        
 Worm   334 MHSVDFSSIANLKDSLANSNSFKIRPAKDGVAHGFSVHFT-----SDLTGHGDNIID-------- 385

  Fly   456 TSPSATPTHWKQTVFFIENPQVVKEGDVICGK 487
               |:....|...:...:.|.:||     |.|
 Worm   386 ---SSKSRAWDLGIIPFKEPCLVK-----CDK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 25/104 (24%)
prmt-9NP_001040990.1 AdoMet_MTases 139..>273 CDD:302624 32/133 (24%)
PRMT5 <153..421 CDD:282971 51/281 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.