DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art3 and strm-1

DIOPT Version :9

Sequence 1:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_497549.2 Gene:strm-1 / 175358 WormBaseID:WBGene00019198 Length:334 Species:Caenorhabditis elegans


Alignment Length:252 Identity:53/252 - (21%)
Similarity:97/252 - (38%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DMERMRNDYKALLQKVHADG---EPKGSDQSVPRNNVCLDNEYFKSYAHF---GIHHEMLSDKVR 227
            |:...::::..|.:|....|   |......||....:   :|||....||   ....:.|.:.::
 Worm    20 DLTNFKSEHDTLYEKALETGDHLEVTSHYYSVMSTVI---DEYFGGNFHFVPPKFEGQKLEEALK 81

  Fly   228 TSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGI----DNSDI---VYTAMDII 285
              :....:.:...:......||:|||.|.:.:..:..| |::.|:    :.::|   .:..|.|.
 Worm    82 --SLHCHIAEKLELSENVHCLDIGCGIGGVMLDIADFG-AKLTGVTIAPNEAEIGNEKFANMGIS 143

  Fly   286 RKNKVENVELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRC 350
            .:.|:...:..|...||:.. :..|.|       |.|.|...||.::...:..|.|.|..:    
 Worm   144 DRCKIVAADCQKMPFEDSTF-DVAYAI-------YSLKYIPNLDKVMKEIQRVLKPGGKFI---- 196

  Fly   351 TLSLLGYGDDTLY-ADEVEFWSNVYEVD----MSDLRKQS-----IEEPLMQVVDAE 397
            ...|:...|   | .|..|.:..::.::    |..|..||     .|:..|.||:.|
 Worm   197 VYDLIKTND---YDKDNKEHYKTLHHLEYACGMPSLHTQSEVEAAAEKWEMPVVERE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 26/109 (24%)
strm-1NP_497549.2 Methyltransf_11 100..197 CDD:285453 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.